The domain within your query sequence starts at position 3 and ends at position 190; the E-value for the KIND domain shown below is 2.3e-80.

VSLAEALEVRGGPLQEEEIWAVLNQSAESLQEVFRRVSIADPAALGFIISPWSLLLLPSG
SVSFTDENVSNQDLRAFTAPEVLQSHSLTSLADVEKIHIYSLGMTLYWGADHEVPQSQPI
KLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGNISG
TDPLSRSS

KIND

kinase non-catalytic C-lobe domain
KIND
SMART accession number:SM00750
Description: It is an interaction domain identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). Its presence at the N terminus of signalling proteins and the absence of the active-site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of KIND only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features
Interpro abstract (IPR011019):

The KIND (kinase non-catalytic C-lobe domain) is a putative protein interaction domain, which has been identified as being similar to the C-terminal protein kinase catalytic fold (C lobe).

The presence of the KIND domain at the N terminus of signalling proteins and the absence of the active site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of the domain only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features [ (PUBMED:12877999) (PUBMED:16099729) ]. In SPIRE1 (protein spire homologue 1) this domain interacts with FMN2 (formin-2) [ (PUBMED:21730168) (PUBMED:21705804) ].

Family alignment:
View or

There are 2650 KIND domains in 2324 proteins in SMART's nrdb database.

Click on the following links for more information.