The domain within your query sequence starts at position 52 and ends at position 178; the E-value for the Kin17_mid domain shown below is 5.41e-89.

RQLLLASENPQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQ
WETLTDFTKWLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKKQDLDDEEKTAK
FIEEQVR

Kin17_mid

Domain of Kin17 curved DNA-binding protein
Kin17_mid
SMART accession number:SM01253
Description: Kin17_mid is the conserved central 169 residue region of a family of Kin17 proteins. Towards the N-terminal end there is a zinc-finger domain, and in human and mouse members there is a RecA-like domain further downstream. The Kin17 protein in humans forms intra-nuclear foci during cell proliferation and is re-distributed in the nucleoplasm during the cell cycle (PUBMED:10964102).
Interpro abstract (IPR019447):

This entry represents the conserved central 169 residue region of the Kin17 DNA/RNA-binding proteins. The N-terminal region of Kin17 contains a zinc-finger domain, while in the human and mouse proteins there is a RecA-like domain found in the C-terminal region. In humans, Kin17 protein forms intra-nuclear foci during cell proliferation and is re-distributed in the nucleoplasm during the cell cycle [ (PUBMED:10964102) ].

Family alignment:
View or

There are 1678 Kin17_mid domains in 1676 proteins in SMART's nrdb database.

Click on the following links for more information.