The domain within your query sequence starts at position 25 and ends at position 98; the E-value for the L51_S25_CI-B8 domain shown below is 1.74e-28.

QRSPGSQGVRDFIVQRYVELKKAHPNLPILIRECSEVQPKLWARYAFGQEKTVSLNNLSA
DEVTRAMQNVLSGK

L51_S25_CI-B8

Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
L51_S25_CI-B8
SMART accession number:SM00916
Description: Proteins containing this domain are located in the mitochondrion and include ribosomal protein L51, and S25. This domain is also found in mitochondrial NADH-ubiquinone oxidoreductase B8 subunit (CI-B8) . It is not known whether all members of this family form part of the NADH-ubiquinone oxidoreductase and whether they are also all ribosomal proteins.
Interpro abstract (IPR007741):

Proteins containing this domain are located in the mitochondrion and include ribosomal protein L51, and S25. This domain is also found in mitochondrial NADH-ubiquinone oxidoreductase B8 subunit (CI-B8) EC 1.6.5.3 . It is not known whether all members of this family form part of the NADH-ubiquinone oxidoreductase and whether they are also all ribosomal proteins.

Family alignment:
View or

There are 3843 L51_S25_CI-B8 domains in 3831 proteins in SMART's nrdb database.

Click on the following links for more information.