The domain within your query sequence starts at position 12 and ends at position 143; the E-value for the LAG1_DNAbind domain shown below is 2.3e-90.

TVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIG
NSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISK
PSKKKQSLKNAD

LAG1_DNAbind

LAG1, DNA binding
LAG1_DNAbind
SMART accession number:SM01267
Description: Members of this family are found in various eukaryotic hypothetical proteins and in the DNA-binding protein LAG-1. They adopt a beta sandwich structure, with nine strands in two beta-sheets, in a Greek-key topology, and allow for DNA binding (PUBMED:15297877). This domain is also known as RHR-N (Rel-homology region) as it related to Rel domain proteins.
Interpro abstract (IPR015351):

This domain is found in RBP-J from human and Cbf11/Cbf12 from fission yeast. These proteins function as transcription factors [ (PUBMED:19101542) (PUBMED:23303788) ]. This domain adopts a beta sandwich structure, with nine strands in two beta-sheets, in a Greek-key topology, and allow for DNA binding [ (PUBMED:15297877) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634)
GO function:DNA-binding transcription factor activity (GO:0003700), DNA binding (GO:0003677)
Family alignment:
View or

There are 1473 LAG1_DNAbind domains in 1470 proteins in SMART's nrdb database.

Click on the following links for more information.