The domain within your query sequence starts at position 55 and ends at position 399; the E-value for the LANC_like domain shown below is 7.17e-144.
DPRDGTGYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKQSLNCLSRRSITFLCGDAGPL AVAAVLYHKMNSEKQAEECITRLIHLNKIDPHVPNEMLYGRIGYIFALLFVNKNFGEEKI PQSHIQQICENILTSGENLSRKRNLAAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQ VNQGKLHSLVKPSVDFVCRLKFPSGNYPPCLDDTRDLLVHWCHGAPGVIYMLIQAYKVFK EERYLCDAQQCADVIWQYGLLKKGYGLCHGAAGNAYAFLALYNLTQDLKYLYRACKFAEW CLDYGEHGCRTADTPFSLFEGMAGTIYFLADLLVPTKAKFPAFEL
LANC_likeLanthionine synthetase C-like protein |
---|
SMART accession number: | SM01260 |
---|---|
Description: | Lanthionines are thioether bridges that are putatively generated by dehydration of Ser and Thr residues followed by addition of cysteine residues within the peptide. This family contains the lanthionine synthetase C-like proteins 1 and 2 which are related to the bacterial lanthionine synthetase components C (LanC). LANCL1 (P40 seven-transmembrane-domain protein) and LANCL2 (testes-specific adriamycin sensitivity protein) are thought to be peptide-modifying enzyme components in eukaryotic cells. Both proteins are produced in large quantities in the brain and testes and may have role in the immune surveillance of these organs (PUBMED:11376939). Lanthionines are found in lantibiotics, which are peptide-derived, post-translationally modified antimicrobials produced by several bacterial strains (PUBMED:12127987). This region contains seven internal repeats. |
Interpro abstract (IPR007822): | The LanC-like protein superfamily encompasses a highly divergent group of peptide-modifying enzymes, including the eukaryotic and bacterial lanthionine synthetase C-like proteins (LanC) [ (PUBMED:11474189) (PUBMED:10944443) (PUBMED:12566319) ]; subtilin biosynthesis protein SpaC from Bacillus subtilis [ (PUBMED:1735728) (PUBMED:1539969) ]; epidermin biosynthesis protein EpiC from Staphylococcus epidermidis [ (PUBMED:1740156) ]; nisin biosynthesis protein NisC from Lactococcus lactis [ (PUBMED:8161176) (PUBMED:7689965) (PUBMED:1482192) ]; GCR2 from Arabidopsis thaliana [ (PUBMED:17347412) ]; and many others. The 3D structure of the lantibiotic cyclase from L. lactis has been determined by X-ray crystallography to 2.5A resolution [ (PUBMED:16527981) ]. The globular structure is characterised by an all-alpha fold, in which an outer ring of helices envelops an inner toroid composed of 7 shorter, hydrophobic helices. This 7-fold hyrophobic periodicity has led several authors to claim various members of the family, including eukaryotic LanC-1 and GCR2, to be novel G protein-coupled receptors [ (PUBMED:17347412) (PUBMED:9512664) ]; some of these claims have since been corrected [ (PUBMED:10944443) (PUBMED:18086512) (PUBMED:17894782) ]. The C terminus of the lantibiotic biosynthesis protein LanM is homologous to LanC [ (PUBMED:19393544) (PUBMED:23071302) ]. LanC-like protein 1 (included in this family) has been shown to function as a glutathione transferase, and as such has been renamed to Glutathione S-transferase LANCL1 [ (PUBMED:19528316) ]. |
Family alignment: |
There are 8676 LANC_like domains in 8665 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)