The domain within your query sequence starts at position 37 and ends at position 129; the E-value for the LINK domain shown below is 2.49e-27.

IMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVI
PRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHN

LINK

Link (Hyaluronan-binding)
LINK
SMART accession number:SM00445
Description: -
Interpro abstract (IPR000538):

The link domain [ (PUBMED:8318021) ] is a hyaluronan(HA)-binding region found in proteins of vertebrates that are involved in the assembly of extracellular matrix, cell adhesion, and migration. The structure has been shown [ (PUBMED:8797823) ] to consist of two alpha helices and two antiparallel beta sheets arranged around a large hydrophobic core similar to that of C-type lectin. This domain contains four conserved cysteines involved in two disulphide bonds. The link domain has also been termed HABM [ (PUBMED:8318021) ] (HA binding module) and PTR [ (PUBMED:8690089) ] (proteoglycan tandem repeat). Proteins with such a domain include the proteoglycans aggrecan, brevican, neurocan and versican, which are expressed in the CNS; the cartilage link protein (LP), a proteoglycan that together with HA and aggrecan forms multimolecular aggregates; Tumour necrosis factor-inducible protein TSG-6, which may be involved in cell-cell and cell-matrix interactions during inflammation and tumourgenesis; and CD44 antigen, the main cell surface receptor for HA.

GO process:cell adhesion (GO:0007155)
GO function:hyaluronic acid binding (GO:0005540)
Family alignment:
View or

There are 10282 LINK domains in 6262 proteins in SMART's nrdb database.

Click on the following links for more information.