The domain within your query sequence starts at position 675 and ends at position 831; the E-value for the LNS2 domain shown below is 3.42e-100.

KNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDW
THQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLHWVNERGTVLPQGPLLLSPSSLF
SALHREVIEKKPEKFKVQCLTDIKNLFFPNTEPFYAA

LNS2

LNS2
SMART accession number:SM00775
Description: This domain is found in Saccharomyces cerevisiae protein SMP2, proteins with an N-terminal lipin domain and phosphatidylinositol transfer proteins. SMP2 is involved in plasmid maintenance and respiration. Lipin proteins are involved in adipose tissue development and insulin resistance.
Interpro abstract (IPR031315):

This domain is found in lipins, lipin homologues from Saccharomyces cerevisiae (Smp2, PAH1) [(PUBMED:16467296)] and Schizosaccharomyces pombe (Ned1) [(PUBMED:12376568)], and in class II phosphatidylinositol transfer proteins (PITP) [(PUBMED:23916246)]. Lipin proteins are phosphatidate phosphatases which catalyse the dephosphorylation of phosphatidic acid to diacylglycerol, the penultimate step in triacylglycerol synthesis [(PUBMED:23603613)].

Family alignment:
View or

There are 5196 LNS2 domains in 5194 proteins in SMART's nrdb database.

Click on the following links for more information.