The domain within your query sequence starts at position 83 and ends at position 320; the E-value for the LON domain shown below is 2.33e-41.

VIPVLPEVLMILIPGQTLPLQLSHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTA
EIYAYREEQEFGIEVVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQL
ESLNKCQVFPSKPISWEDQYSCKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKK
QLREWDENLKDDSLPENPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNK

LON

Found in ATP-dependent protease La (LON)
LON
SMART accession number:SM00464
Description: N-terminal domain of the ATP-dependent protease La (LON), present also in other bacterial ORFs.
Interpro abstract (IPR003111):

This signature defines the N-terminal substrate-binding domain of the archael, bacterial and eukaryotic lon proteases, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). In the eukaryotes the majority of the proteins are located in the mitochondrial matrix [(PUBMED:8248235), (PUBMED:9620272)]. In yeast, Pim1, is located in the mitochondrial matrix, is required for mitochondrial function, is constitutively expressed but is increased after thermal stress, suggesting that Pim1 may play a role in the heat shock response [(PUBMED:8276800)].

This structure of this domain has been determined [(PUBMED:16199667), (PUBMED:19191354), (PUBMED:20834233)]. This domain also occurs in proteins which lack the peptidase domain, such as the SPBC14F5.10c gene product from Schizosaccharomyces pombe; these proteins are uncharacterized.

Family alignment:
View or

There are 17617 LON domains in 17613 proteins in SMART's nrdb database.

Click on the following links for more information.