The domain within your query sequence starts at position 444 and ends at position 589; the E-value for the LamG domain shown below is 1.75e-9.

PECNISLRFHTVQPNALLLIRGNKDVSMKLELLNGCVHLSIEVWNQLKVLLSISHNTSDG
EWHFVEVTIAETLTLALVGGSCKEKCTTKSSVPVENHQSICALQDSFLGGLPMGTANNSV
SVLNIYNVPSTPSFVGCLQDIRFDLN

LamG

Laminin G domain
LamG
SMART accession number:SM00282
Description: -
Family alignment:
View or

There are 19165 LamG domains in 8376 proteins in SMART's nrdb database.

Click on the following links for more information.