The domain within your query sequence starts at position 673 and ends at position 798; the E-value for the LamG domain shown below is 1.05e-7.

QNFSLSMFVRTRQPLGLLLALENSTYQYVSVWLEHGSLALQTPGSPKFMVNFFLSDGNVH
LISLRIKPNEIELYQSSQNLGFISVPTWTIRRGDVIFIGGLPDREKTEVYGGFFKGCVQD
VRLNSQ

LamG

Laminin G domain
LamG
SMART accession number:SM00282
Description: -
Family alignment:
View or

There are 19165 LamG domains in 8376 proteins in SMART's nrdb database.

Click on the following links for more information.