The domain within your query sequence starts at position 114 and ends at position 263; the E-value for the LamGL domain shown below is 1.55e-54.

DAFTLQVWLRAEGGQKSPAVITGLYDKCSYTSRDRGWVMGIHTTSDQGNRDPRYFFSLKT
DRARKVTTIDAHRSYLPGQWVHLAATYDGRLMKLYMNGAQVATSAEQVGGIFSPLTQKCK
VLMLGGSALNHNFRGHIEHFSLWKVARTQR

LamGL

LamG-like jellyroll fold domain
LamGL
SMART accession number:SM00560
Description: -
Interpro abstract (IPR006558):

This LamG-like jellyroll fold domain is found in the metalloproteinase Pappalysin-1 [(PUBMED:17314100)] and Usherin [(PUBMED:17360538)]. Its function is unknown.

Family alignment:
View or

There are 2130 LamGL domains in 997 proteins in SMART's nrdb database.

Click on the following links for more information.