The domain within your query sequence starts at position 29 and ends at position 281; the E-value for the LamNT domain shown below is 5.35e-129.

AHQQRGLFPAVLNLASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQCRICNQNSSN
PYQRHPITNAIDGKNTWWQSPSIKNGVEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNW
ILERSLDDVEYKPWQYHAVTDTECLTLYNIYPRTGPPSYAKDDEVICTSFYSKIHPLENG
EIHISLINGRPSADDPSPELLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTR
RYYYSVKDISVGG

LamNT

Laminin N-terminal domain (domain VI)
LamNT
SMART accession number:SM00136
Description: N-terminal domain of laminins and laminin-related protein such as Unc-6/ netrins.
Interpro abstract (IPR008211):

Laminin is a large molecular weight glycoprotein present only in basement membranes in almost every animal tissue. It is thought to mediate the attachment, migration and organisation of cells into tissues during embryonic development by interacting with other extracellular matrix components [ (PUBMED:1975589) ]. Each laminin is a heterotrimer assembled from alpha, beta and gamma chain subunits, secreted and incorporated into cell-associated extracellular matrices [ (PUBMED:10842354) ].

Basement membrane assembly is a cooperative process in which laminins polymerise through their N-terminal domain (LN or domain VI) and anchor to the cell surface through their G domains. Netrins may also associate with this network through heterotypic LN domain interactions [ (PUBMED:8349613) ]. This leads to cell signalling through integrins and dystroglycan (and possibly other receptors) recruited to the adherent laminin. This LN domain dependent self-assembly is considered to be crucial for the integrity of basement membranes, as highlighted by genetic forms of muscular dystrophy containing the deletion of the LN module from the alpha 2 laminin chain [ (PUBMED:7874173) ]. The laminin N-terminal domain is found in all laminin and netrin subunits except laminin alpha 3A, alpha 4 and gamma 2.

Family alignment:
View or

There are 8957 LamNT domains in 8947 proteins in SMART's nrdb database.

Click on the following links for more information.