The domain within your query sequence starts at position 523 and ends at position 668; the E-value for the Leuk-A4-hydro_C domain shown below is 1.31e-46.

SLTRPVEALFQLWTAEPLEQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVVMSLS
KCYSSLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALK
SFALEVFYQTQGRLHPNLRRTIQQIL

Leuk-A4-hydro_C

Leukotriene A4 hydrolase, C-terminal
Leuk-A4-hydro_C
SMART accession number:SM01263
Description: Members of this family adopt a structure consisting of two layers of parallel alpha-helices, five in the inner layer and four in the outer, arranged in an antiparallel manner, with perpendicular loops containing short helical segments on top. They are required for the formation of a deep cleft harbouring the catalytic Zn2+ site in Leukotriene A4 hydrolase (PUBMED:11175901).
Interpro abstract (IPR015211):

This C-terminal domain is found in peptidases belonging to MEROPS peptidase family M1, particularly: aminopeptidase-1 of Caenorhabditis elegans, aminopeptidase O, aminopeptidase B and the bifunctional leukotriene A4 (LTA-4) hydrolase/aminopeptidase.

The domain adopts a structure consisting of two layers of parallel alpha-helices, five in the inner layer and four in the outer, arranged in an antiparallel manner, with perpendicular loops containing short helical segments on top. It is required for the formation of a deep cleft harbouring the catalytic Zn2+ site in leukotriene A4 hydrolase [ (PUBMED:11175901) ].

GO function:zinc ion binding (GO:0008270), metallopeptidase activity (GO:0008237)
Family alignment:
View or

There are 3901 Leuk-A4-hydro_C domains in 3898 proteins in SMART's nrdb database.

Click on the following links for more information.