The domain within your query sequence starts at position 5 and ends at position 43; the E-value for the Lipid_DES domain shown below is 4.36e-20.

VSREEFEWVYTDQPHAARRKEILAKYPEIKSLMKPDHNL

Lipid_DES

Sphingolipid Delta4-desaturase (DES)
Lipid_DES
SMART accession number:SM01269
Description: Sphingolipids are important membrane signalling molecules involved in many different cellular functions in eukaryotes. Sphingolipid delta 4-desaturase catalyses the formation of (E)-sphing-4-enine (PUBMED:11937514). Some proteins in this family have bifunctional delta 4-desaturase/C-4-hydroxylase activity. Delta 4-desaturated sphingolipids may play a role in early signalling required for entry into meiotic and spermatid differentiation pathways during Drosophila spermatogenesis (PUBMED:119375141). This small domain associates with FA_desaturase (PFAM PF00487) and appears to be specific to sphingolipid delta 4-desaturase.
Interpro abstract (IPR013866):

This small domain appears to be specific to sphingolipid delta 4-desaturase. Sphingolipids are important membrane signalling molecules involved in many different cellular functions in eukaryotes. Sphingolipid delta 4-desaturase catalyses the formation of (E)-sphing-4-enine [ (PUBMED:11937514) ]. Some proteins with this domain have bifunctional delta 4-desaturase/C-4-hydroxylase activity. Delta 4-desaturated sphingolipids may play a role in early signalling required for entry into meiotic and spermatid differentiation pathways during Drosophila spermatogenesis [ (PUBMED:11937514) ].

Family alignment:
View or

There are 1787 Lipid_DES domains in 1784 proteins in SMART's nrdb database.

Click on the following links for more information.