The domain within your query sequence starts at position 11 and ends at position 54; the E-value for the LysM domain shown below is 2.48e-9.
EYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVP
LysMLysin motif |
---|
SMART accession number: | SM00257 |
---|---|
Description: | - |
Interpro abstract (IPR018392): | The LysM (lysin motif) domain is a small globular domain, approximately 40 amino acids long. It is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls [ (PUBMED:1352512) ], but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis [ (PUBMED:15120137) ]. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes [ (PUBMED:10369758) ]. |
Family alignment: |
There are 136958 LysM domains in 89509 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)