The domain within your query sequence starts at position 504 and ends at position 752; the E-value for the M16C_associated domain shown below is 2.8e-114.

ELQTQQSKHQDASCLPALKVSDIEPSMPFTKLDIGLAAGDIPVQYCPQPTNGMVYFRAFS
SLNTLPEDLRPIVPLFCSVLTKLGCGILNYREQAQQIELKTGGMSVTPHVLPDDSQLDTY
EQGVLFSSLCLERNLPDMMHLWSEIFNNPCFEEEEHFKVLVKMTAQELSNGISDSGHLYA
ALRASKTLTPSGDLQETFSGMDQVKVMKRIAEMTDIKPILRKLPRIKKYLLNCDNMRCSV
NATPQQMPQ

M16C_associated

Peptidase M16C associated
M16C_associated
SMART accession number:SM01264
Description: This domain appears in eukaryotes as well as bacteria and tends to be found near the C-terminus of the metalloprotease (PFAM PF05193).
Interpro abstract (IPR013578):

This domain appears in eukaryotes as well as bacteria and tends to be found near the C terminus of metalloproteases and related sequences belonging to MEROPS peptidase family M16 (subfamily M16C, clan ME), PreP subfamily. PREP is an ATP-independent protease that degrades both mitochondrial and chloroplastic transit peptides after their cleavage. It also degrades other unstructured peptides [ (PUBMED:12138166) ].

GO process:proteolysis (GO:0006508)
Family alignment:
View or

There are 4384 M16C_associated domains in 4384 proteins in SMART's nrdb database.

Click on the following links for more information.