The domain within your query sequence starts at position 504 and ends at position 752; the E-value for the M16C_associated domain shown below is 2.8e-114.
ELQTQQSKHQDASCLPALKVSDIEPSMPFTKLDIGLAAGDIPVQYCPQPTNGMVYFRAFS SLNTLPEDLRPIVPLFCSVLTKLGCGILNYREQAQQIELKTGGMSVTPHVLPDDSQLDTY EQGVLFSSLCLERNLPDMMHLWSEIFNNPCFEEEEHFKVLVKMTAQELSNGISDSGHLYA ALRASKTLTPSGDLQETFSGMDQVKVMKRIAEMTDIKPILRKLPRIKKYLLNCDNMRCSV NATPQQMPQ
M16C_associatedPeptidase M16C associated |
---|
SMART accession number: | SM01264 |
---|---|
Description: | This domain appears in eukaryotes as well as bacteria and tends to be found near the C-terminus of the metalloprotease (PFAM PF05193). |
Interpro abstract (IPR013578): | This domain appears in eukaryotes as well as bacteria and tends to be found near the C terminus of metalloproteases and related sequences belonging to MEROPS peptidase family M16 (subfamily M16C, clan ME), PreP subfamily. PREP is an ATP-independent protease that degrades both mitochondrial and chloroplastic transit peptides after their cleavage. It also degrades other unstructured peptides [ (PUBMED:12138166) ]. |
GO process: | proteolysis (GO:0006508) |
Family alignment: |
There are 4384 M16C_associated domains in 4384 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)