The domain within your query sequence starts at position 533 and ends at position 832; the E-value for the M60-like domain shown below is 3.49e-130.
NSWVSTGLYLPEGQVAQVLLPSEATHAKLKVLIGCHRDNISQARTYFRPPVMTYVYHLTS SQTSISWLYGGLLYIMVPNKYNQDNVSVTIRGAVSAPYFRLGKTTQEEWKNLITHSKAPW GELATDNIILTIPTVNLKELQDPYPLLQLWDKMVRAVAKLAARPFPFQRAERVVLDKQIS FGFLHSGYPIMGLISIVEGIISEFKIRSHGIWGVIHELGHNHQKSGWTFPPHTTEALCNL WTIYVHETVLNIPREQAHPSLNPELRRQRIKYHLNKGAPLSNWIMWTALETYLQLQEGFG
M60-likePeptidase M60-like family |
---|
SMART accession number: | SM01276 |
---|---|
Description: | This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity PMID:22299034. |
Interpro abstract (IPR031161): | Some proteins known to contain a peptidase family M60 domain are listed below:
The peptidase family M60 domain belongs to the Merops zincin superfamily of zinc-requiring metalloproteases (clan MA, subclan MA(E)). The peptidase family M60 domain contains the metal-binding consensus motif HExxH. The two histidine residues are ligands of the catalytic Zn(2) and the glutamic acid residue is involved in nucleophilic attack. An additional conserved glutamic acid is found approximately 20 residues from the first histidine within the metal-binding motif. The second conserved glutamic acid potentially acts as a third proteous Zn(2) ligand. The peptidase family M60 domain targets complex host glycoproteins, such as mucins [ (PUBMED:9343163) (PUBMED:16081094) (PUBMED:16790012) (PUBMED:22238230) (PUBMED:22299034) ]. |
Family alignment: |
There are 4053 M60-like domains in 4048 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)