The domain within your query sequence starts at position 103 and ends at position 273; the E-value for the MAGE domain shown below is 1e-103.

LVDFLVLKYQMKAFTTKAEMLESIGREYEEYYPLIFSEASECLKMVFGLDMVEIDPSVHS
YILVTALGITYDGMMTDVQGMPKTGILIAVLSVIFMKGNYVSEEIIWEMLNNIGLYGGRN
PYIHKDPRKLISEEFVQEGYLEYRQVPNSDPPSYGFLWGPRAFAETSKMKV

MAGE

Melanoma-associated antigen
MAGE
SMART accession number:SM01373
Description: The MAGE (melanoma antigen-encoding gene) family are expressed in a wide variety of tumors but not in normal cells, with the exception of the male germ cells, placenta, and, possibly, cells of the developing embryo. The cellular function of this family is unknown. This family also contains the yeast protein, Nse3. The Nse3 protein is part of the Smc5-6 complex (PMID:15601840, 15331764). Nse3 has been demonstrated to be important for (PMID:15331764).
Interpro abstract (IPR002190):

The first mammalian members of the MAGE (melanoma-associated antigen) gene family were originally described as completely silent in normal adult tissues, with the exception of male germ cells and, for some of them, placenta. By contrast, these genes were expressed in various kinds of tumors. However, other members of the family were recently found to be expressed in normal cells, indicating that the family is larger and more disparate than initially expected. MAGE-like genes have also been identified in non-mammalian species, including Drosophila melanogaster (Fruit fly) and Danio rerio (Zebrafish). Although no MAGE homologous sequences have been identified in Caenorhabditis elegans, Saccharomyces cerevisiae (Baker's yeast) or Schizosaccharomyces pombe (Fission yeast), MAGE sequences have been found in several vegetal species, including Arabidopsis thaliana (Mouse-ear cress) [ (PUBMED:11454705) ].

The only region of homology shared by all of the members of the family is a stretch of about 200 amino acids which has been named the MAGE homology domain. The MAGE homology domain is usually located close to the C-terminal, although it can also be found in a more central position in some proteins. The MAGE homology domain is generally present as a single copy but it is duplicated in some proteins. It has been proposed that the MAGE homology domain of MAGE-D proteins might interact with p75 neurotrophin or related receptors [ (PUBMED:11454705) ].

Proteins known to contain a MAGE domain are listed below:

  • Human MAGE-A, -B and -C proteins. MAGE-A, -B and -C genes are silent in all normal tissues with the exception of testis.
  • Human MAGE-D to -L proteins. MAGE-D to -L genes are expressed in normal adult tissues.
  • Mouse Mage-a and -b proteins.
  • Mouse Mage-d, -e, -g, -h, -k and -l.
  • Mammalian Necdin. The human Necdin gene is a candidate for the Prader-Willi syndrome.
Family alignment:
View or

There are 6200 MAGE domains in 5936 proteins in SMART's nrdb database.

Click on the following links for more information.