The domain within your query sequence starts at position 39 and ends at position 134; the E-value for the MANEC domain shown below is 1.18e-39.

PGGAACLSRFTSGVPSFVLDTEASVSNGATFLGSPTARRGWDCVRSCCTTQNCNLALVEL
QPDGGEDAISACFLMNCLYEQNFVCKFAPKEGFINY

MANEC

MANEC
SMART accession number:SM00765
Description: The MANEC domain was formerly called MANSC. This domain, comprising 8 conserved cysteines, is found in the N terminus of higher multicellular animal membrane and extracellular proteins. It is postulated that this domain may play a role in the formation of protein complexes involving various protease activators and inhibitors. It is possible that some of the cysteine residues in the MANSC domain form structurally important disulfide bridges. All of the MANSC-containing proteins contain predicted transmembrane regions and signal peptides. It has been proposed that the MANSC domain in HAI-1 might function through binding with hepatocyte growth factor activator and matriptase.
Interpro abstract (IPR011106):

The MANSC (motif at N terminus with seven cysteines) domain is a module with a well-conserved seven cysteine motif that is present at the N terminus of higher multicellular animal membrane and extracellular proteins. It is possible that some of the cysteine residues in the MANSC domain form structurally important disulphide bridges. All of the MANSC-containing proteins contain predicted transmembrane regions and signal peptides. It has been proposed that the MANSC domain in HAI-1 might function through binding with hepatocyte growth factor activator and matriptase [ (PUBMED:15124631) ].

Family alignment:
View or

There are 1339 MANEC domains in 1296 proteins in SMART's nrdb database.

Click on the following links for more information.