The domain within your query sequence starts at position 16 and ends at position 94; the E-value for the MIT domain shown below is 4.64e-18.

IKEAYEKAFMFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISIAAAEPGHTGPAWEAAR
QMQQKMKETLQNVRTRLEI

MIT

Microtubule Interacting and Trafficking molecule domain
MIT
SMART accession number:SM00745
Description: -
Interpro abstract (IPR007330):

The MIT domain forms an asymmetric three-helix bundle. It is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking.

A 'variant' MIT domain has been described at the N-terminal region of a related AAA-ATPase, mammalian katanin p60 [(PUBMED:20339000)].

Family alignment:
View or

There are 5412 MIT domains in 4681 proteins in SMART's nrdb database.

Click on the following links for more information.