The domain within your query sequence starts at position 199 and ends at position 394; the E-value for the Mab-21 domain shown below is 1.89e-6.

SYYEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLS
ATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDIILALESKGSW
PISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNH
GIEKTCCESSGAKCCS

Mab-21

Mab-21
SMART accession number:SM01265
Description: This family contains Mab-21 and Mab-21 like proteins. In C. elegans these proteins are required for several aspects of embryonic development (PUBMED:8582275); (PUBMED:15385160).
Interpro abstract (IPR024810):

This domain is present in Mab-21 and Mab-21 like proteins. In Caenorhabditis elegans these proteins are required for several aspects of embryonic development [ (PUBMED:8582275) (PUBMED:15385160) ]. This entry also includes inositol 1,4,5-triphosphate receptor-interacting proteins, which are predicted to contain a partial Mab-21 domain [ (PUBMED:16990268) ].

Family alignment:
View or

There are 5197 Mab-21 domains in 5185 proteins in SMART's nrdb database.

Click on the following links for more information.