The domain within your query sequence starts at position 39 and ends at position 116; the E-value for the NH domain shown below is 2.16e-47.

RKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRC
AATGICCSPDGCRTDPAC

NH

Neurohypophysial hormones
NH
SMART accession number:SM00003
Description: Vasopressin/oxytocin gene family.
Interpro abstract (IPR000981): Oxytocin and vasopressin are nine-residue, structurally and functionally related neurohypophysial peptide hormones. Oxytocin mediates contraction of the smooth muscle of the uterus and mammary gland, while vasopressin has antidiuretic action on the kidney, and mediates vasoconstriction of the peripheral vessels [(PUBMED:3147712)]. In common with most active peptides, both hormones are synthesised as larger protein precursors that are enzymatically converted to their mature forms. Members of this family are found in birds, fish, reptiles and amphibians (mesotocin, isotocin, valitocin, glumitocin, aspargtocin, vasotocin, seritocin, asvatocin, phasvatocin), in worms (annetocin), octopi (cephalotocin), Locusta migratoria (Migratory locust) (locupressin or neuropeptide F1/F2) and in molluscs (conopressins G and S) [(PUBMED:7591488)].
GO component:extracellular region (GO:0005576)
GO function:neurohypophyseal hormone activity (GO:0005185)
Family alignment:
View or

There are 740 NH domains in 737 proteins in SMART's nrdb database.

Click on the following links for more information.