The domain within your query sequence starts at position 1506 and ends at position 1562; the E-value for the NOD domain shown below is 2.98e-24.

PALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFPYHRP

NOD

NOD
SMART accession number:SM01338
Description: NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals (PMID:10221902, 11112321). NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologs in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. Role of NOD domain remains to be elucidated.
Interpro abstract (IPR010660):

NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals [ (PUBMED:10221902) ]. NOD (NOTCH protein domain) represents a region present in many NOTCH proteins and NOTCH homologues in multiple species such as 0, NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. Role of NOD domain remains to be elucidated.

GO process:cell differentiation (GO:0030154)
GO component:integral component of membrane (GO:0016021)
Family alignment:
View or

There are 1409 NOD domains in 1408 proteins in SMART's nrdb database.

Click on the following links for more information.