The domain within your query sequence starts at position 680 and ends at position 744; the E-value for the Nbs1_C domain shown below is 2.14e-34.

LKNFKKFKKATFPGAGKLPHIIGGSDLVGHHARKNTELEEWLKQEMEVQKQQAKEESLAD
DLFRY

Nbs1_C

DNA damage repair protein Nbs1
Nbs1_C
SMART accession number:SM01348
Description: This C terminal region of the DNA damage repair protein Nbs1 has been identified to be necessary for the binding of Mre11 and Tel1 (PMID:15964794).
Interpro abstract (IPR013908):

This C-terminal region of the DNA damage repair protein Nbs1 has been identified to be necessary for the binding of Mre11 and Tel1 [ (PUBMED:15964794) ].

Family alignment:
View or

There are 355 Nbs1_C domains in 354 proteins in SMART's nrdb database.

Click on the following links for more information.