The domain within your query sequence starts at position 253 and ends at position 466; the E-value for the OMPdecase domain shown below is 4.17e-40.

NLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTALAKRHEFLIFED
RKFADIGNTVKKQYESGTFKIASWADIVNAHVVPGSGVVKGLQEVGLPLHRACLLIAEMS
SAGSLATGNYTKAAVGMAEEHCEFVIGFISGSRVSMKPEFLHLTPGVQLETGGDHLGQQY
NSPQEVIGKRGSDVIIVGRGILAAANRLEAAEMY

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family
OMPdecase
SMART accession number:SM00934
Description: Orotidine 5'-phosphate decarboxylase (OMPdecase) (PUBMED:2835631), (PUBMED:1730672) catalyzes the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP. In higher eukaryotes OMPdecase is part, with orotate phosphoribosyltransferase, of a bifunctional enzyme, while the prokaryotic and fungal OMPdecases are monofunctional protein.
Interpro abstract (IPR001754):

Orotidine 5'-phosphate decarboxylase (OMPdecase) [ (PUBMED:2835631) (PUBMED:1730672) ] catalyses the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP. In higher eukaryotes OMPdecase is part, with orotate phosphoribosyltransferase, of a bifunctional enzyme, while the prokaryotic and fungal OMPdecases are monofunctional protein.

Some parts of the sequence of OMPdecase are well conserved across species. The best conserved region is located in the N-terminal half of OMPdecases and is centred around a lysine residue which is essential for the catalytic function of the enzyme.

This entry also includes enzymes such as 3-hexulose-6-phosphate synthase EC 4.1.2.43 and 3-keto-L-gulonate-6-phosphate decarboxylase EC 4.1.1.85 .

GO process:'de novo' pyrimidine nucleobase biosynthetic process (GO:0006207)
GO function:orotidine-5'-phosphate decarboxylase activity (GO:0004590)
Family alignment:
View or

There are 26255 OMPdecase domains in 26251 proteins in SMART's nrdb database.

Click on the following links for more information.