The domain within your query sequence starts at position 139 and ends at position 255; the E-value for the PCRF domain shown below is 5.96e-27.

KSLNKQDEKQLQELVSEERQIIDQKIHRLYSELLERLVPKEKYDWSDVILEVTSGRTTGG
DICQQFTREIFDMYQNYSYYKHWKFELLNYTPADYGGLHHAAARISGDSVYKHLKYE

PCRF

PCRF
SMART accession number:SM00937
Description: This domain is found in peptide chain release factors.
Interpro abstract (IPR005139):

This domain is found in bacterial, mitochondrial and chloroplastic peptide chain release factors. In bacteria, termination of protein synthesis depends on the type I release factors, RF1 and RF2 [(PUBMED:2215213)]. Both contain this domain.

GO process:translational termination (GO:0006415)
Family alignment:
View or

There are 39330 PCRF domains in 39328 proteins in SMART's nrdb database.

Click on the following links for more information.