The domain within your query sequence starts at position 1 and ends at position 53; the E-value for the 1wyn domain shown below is 3e-21.

MKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTR

This is a PDB domain - please see the PDBSUM entry of 1wyn for further annotation