The domain within your query sequence starts at position 42 and ends at position 104; the E-value for the 2jw2 domain shown below is 8e-33.

EIEAKEACDWLRAAGFPQYAQLYEDSQFPINIAAVKKDHDFLERDLVEPLCRVTTQMRKT
CAS

This is a PDB domain - please see the PDBSUM entry of 2jw2 for further annotation