The domain within your query sequence starts at position 20 and ends at position 103; the E-value for the PDZ domain shown below is 8.65e-19.

VSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNA
SHAEAVEAIKSAGNPVVFVVQSLS

PDZ

Domain present in PSD-95, Dlg, and ZO-1/2.

• SMART accession number: SM00228
• Description: Also called DHR (Dlg homologous region) or GLGF (relatively well conserved tetrapeptide in these domains). Some PDZs have been shown to bind C-terminal polypeptides; others appear to bind internal (non-C-terminal) polypeptides. Different PDZs possess different binding specificities.
• Interpro abstract (IPR001478):

  PDZ domains (also known as Discs-large homologous regions (DHR) or GLGF)) are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [(PUBMED:9041651), (PUBMED:9204764)]. PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences [(PUBMED:9204764)]. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated.

  PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.

• GO function: protein binding (GO:0005515)

There are 24731 PDZ domains in 17043 proteins in SMART's nrdb database.

Cellular role (predicted cellular role)

Cellular role: signalling
Binding / catalysis: protein-binding, C-terminal peptide-bindin

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Beebe KD, Shin J, Peng J, Chaudhury C, Khera J, Pei D
• Substrate recognition through a PDZ domain in tail-specific protease.
• Biochemistry. 2000; 39: 3149-55

Tail-specific protease (Tsp) is a periplasmic enzyme that selectively degrades proteins bearing a nonpolar C-terminus. Its substrate specificity suggests that Tsp may contain a substrate recognition domain, which selectively binds to the nonpolar C-termini of substrate proteins, separate from its catalytic site. In this work, we show that substrate recognition of Tsp is mediated by a PDZ domain, a small protein module that promotes protein-protein interactions by binding to internal or C-terminal sequences of their partner proteins. Partial proteolysis by V8 protease at a single peptide bond immediately N-terminal to the PDZ domain resulted in two distinct and relatively stable fragments and complete loss of catalytic activity. Photoaffinity labeling with a fluorescent nonpolar peptide caused the covalent attachment of the peptide to a single site on the Tsp protein. Systematic deletion mutagenesis of Tsp localized the binding site to amino acids 206-307, a region that completely encompasses the putative PDZ domain (217-301). The isolated PDZ domain (amino acids 206-334) is capable of folding into a well-behaved structure and binds to a nonpolar peptide with a dissociation constant (K(D)) of 1.9 microM, similar to that of the intact Tsp protein. Site-directed mutagenesis of a surface residue at the peptide binding site of the PDZ domain, valine 229, to Glu or Gln resulted in an increase in the K(M) value but had no effect on the k(cat) value. The use of a separate substrate recognition domain such as a PDZ domain may be a general mechanism for achieving selective protein degradation.

• Craven SE, Bredt DS
• PDZ proteins organize synaptic signaling pathways.
• Cell. 1998; 93: 495-8

• Weimbs T, Mostov K, Low SH, Hofmann K
• A model for structural similarity between different SNARE complexes based on sequence relationships.
• Trends Cell Biol. 1998; 8: 260-2

• Cowburn D
• Peptide recognition by PTB and PDZ domains.
• Curr Opin Struct Biol. 1997; 7: 835-8

Protein tyrosine binding (PTB) and 'post synaptic density disc-large zo-1' (PDZ) domains bind to short peptidic ligands by augmentation of one of the domain's beta sheets and other recognition mechanisms. The two domain classes have a superficial resemblance to each other, even though no sequential homology exists. The structural bases of the interactions are well understood for the few domains now experimentally determined, and ligand-target pairs can probably be identified in favorable cases by analogy with the known domains. For both PTB and PDZ classes, functional activities are still not fully defined: it is possible that these domain classes, along with pleckstrin homology domains, have multiple roles.

• Kim SK
• Polarized signaling: basolateral receptor localization in epithelial cells by PDZ-containing proteins.
• Curr Opin Cell Biol. 1997; 9: 853-9

Extracellular signals are normally presented to one surface of epithelial cells and to one end of neurons, and so neuronal and epithelial cell signaling is inherently polarized. Another aspect of signaling polarity is that receptors are often asymmetrically distributed on the surfaces of polarized cells. Recent evidence from studies of Caenorhabditis elegans shows that signaling polarity plays an important role in development. The underlying mesoderm induces the overlying ectoderm to form the vulva, and asymmetric distribution of the signal receptor on the basolateral surface of the epithelium is crucial for this signaling. In neurons, the localization of neurotransmitter receptors and ion channels at synapses allows neurons to be exquisitely sensitive to synaptic inputs. Exciting recent reports suggest that receptor localization to neuronal synapses and the basolateral membrane domains of epithelia may involve a common molecular mechanism involving localization by PDZ-containing proteins.

• Kornau HC, Seeburg PH, Kennedy MB
• Interaction of ion channels and receptors with PDZ domain proteins.
• Curr Opin Neurobiol. 1997; 7: 368-73

The complex anatomy of neurons demands a high degree of functional organization. Therefore, membrane receptors and ion channels are often localized to selected subcellular sites and coupled to specific signal transduction machineries. PDZ domains have come into focus as protein interaction modules that mediate the binding of a class of submembraneous proteins to membrane receptors and ion channels and thus subserve these organizational aspects. The structures of two PDZ domains have been resolved, which has led to a structural understanding of the specificity of interactions of various PDZ domains with their respective partners. The functional implications of PDZ domain interactions are now being addressed in vitro and in vivo.

• Ponting CP
• Evidence for PDZ domains in bacteria, yeast, and plants.
• Protein Sci. 1997; 6: 464-8

Several dozen signaling proteins are now known to contain 80-100 residue repeats, called PDZ (or DHR or GLGF) domains, several of which interact with the C-terminal tetrapeptide motifs X-Ser/Thr-X-Val-COO- of ion channels and/or receptors. PDZ domains have previously been noted only in mammals, flies, and worms, suggesting that the primordial PDZ domain arose relatively late in eukaryotic evolution. Here, techniques of sequence analysis-including local alignment, profile, and motif database searches-indicate that PDZ domain homologues are present in yeast, plants, and bacteria. It is suggested that two PDZ domains occur in bacterial high-temperature requirement A (htrA) and one in tail-specific protease (tsp) homologues, and that a yeast htrA homologue contains four PDZ domains. Sequence comparisons suggest that the spread of PDZ domains in these diverse organisms may have occurred via horizontal gene transfer. The known affinity of Escherichia coli tsp for C-terminal polypeptides is proposed to be mediated by its PDZ-like domain, in a similar manner to the binding of C-terminal polypeptides by animal PDZ domains.

• Ponting CP, Phillips C, Davies KE, Blake DJ
• PDZ domains: targeting signalling molecules to sub-membranous sites.
• Bioessays. 1997; 19: 469-79

PDZ (also called DHR or GLGF) domains are found in diverse membrane-associated proteins including members of the MAGUK family of guanylate kinase homologues, several protein phosphatases and kinases, neuronal nitric oxide synthase, and several dystrophin-associated proteins, collectively known as syntrophins. Many PDZ domain-containing proteins appear to be localised to highly specialised submembranous sites, suggesting their participation in cellular junction formation, receptor or channel clustering, and intracellular signalling events. PDZ domains of several MAGUKs interact with the C-terminal polypeptides of a subset of NMDA receptor subunits and/or with Shaker-type K+ channels. Other PDZ domains have been shown to bind similar ligands of other transmembrane receptors. Recently, the crystal structures of PDZ domains, with and without ligand, have been determined. These demonstrate the mode of ligand-binding and the structural bases for sequence conservation among diverse PDZ domains.

• Ranganathan R, Ross EM
• PDZ domain proteins: scaffolds for signaling complexes.
• Curr Biol. 1997; 7: 7703-7703

InaD, a Drosophila photoreceptor scaffolding protein, assembles multiple signal-transducing proteins at the membrane via its five PDZ domains, enhancing speed and efficiency of vision. Extensive conservation of PDZ domains suggests that these motifs have a general role in organizing diverse signaling complexes.

• Songyang Z et al.
• Recognition of unique carboxyl-terminal motifs by distinct PDZ domains.
• Science. 1997; 275: 73-7

The oriented peptide library technique was used to investigate the peptide-binding specificities of nine PDZ domains. Each PDZ domain selected peptides with hydrophobic residues at the carboxyl terminus. Individual PDZ domains selected unique optimal motifs defined primarily by the carboxyl terminal three to seven residues of the peptides. One family of PDZ domains, including those of the Discs Large protein, selected peptides with the consensus motif Glu-(Ser/Thr)-Xxx-(Val/Ile) (where Xxx represents any amino acid) at the carboxyl terminus. In contrast, another family of PDZ domains, including those of LIN-2, p55, and Tiam-1, selected peptides with hydrophobic or aromatic side chains at the carboxyl terminal three residues. On the basis of crystal structures of the PSD-95-3 PDZ domain, the specificities observed with the peptide library can be rationalized.

• Doyle DA, Lee A, Lewis J, Kim E, Sheng M, MacKinnon R
• Crystal structures of a complexed and peptide-free membrane protein-binding domain: molecular basis of peptide recognition by PDZ.
• Cell. 1996; 85: 1067-76

Modular PDZ domains, found in many cell junction-associated proteins, mediate the clustering of membrane ion channels by binding to their C-terminus. The X-ray crystallographic structures of the third PDZ domain from the synaptic protein PSD-95 in complex with and in the absence of its peptide ligand have been determined at 1.8 angstroms and 2.3 angstroms resolution, respectively. The structures reveal that a four-residue C-terminal stretch (X-Thr/Ser-X-Val-COO(-)) engages the PDZ domain through antiparallel main chain interactions with a beta sheet of the domain. Recognition of the terminal carboxylate group of the peptide is conferred by a cradle of main chain amides provided by a Gly-Leu-Gly-Phe loop as well as by an arginine side chain. Specific side chain interactions and a prominent hydrophobic pocket explain the selective recognition of the C-terminal consensus sequence.

• Fanning AS, Anderson JM
• Protein-protein interactions: PDZ domain networks.
• Curr Biol. 1996; 6: 1385-8

PDZ domains can dimerize or bind to the carboxyl termini of unrelated proteins. Crystallographic studies demonstrate the structural basis for these interactions, which contribute to the ability of PDZ domains to create networks associated with the plasma membrane.

• Gomperts SN
• Clustering membrane proteins: It's all coming together with the PSD-95/SAP90 protein family.
• Cell. 1996; 84: 659-62

• MoraisCabral JH et al.
• Crystal structure of a PDZ domain.
• Nature. 1996; 382: 649-52

PDZ domains (also known as DHR domains or GLGF repeats) are approximately 90-residue repeats found in a number of proteins implicated in ion-channel and receptor clustering, and the linking of receptors to effector enzymes. PDZ domains are protein-recognition modules; some recognize proteins containing the consensus carboxy-terminal tripeptide motif S/TXV with high specificity. Other PDZ domains form homotypic dimers: the PDZ domain of the neuronal enzyme nitric oxide synthase binds to the PDZ domain of PSD-95, an interaction that has been implicated in its synaptic association. Here we report the crystal structure of the third PDZ domain of the human homologue of the Drosophila discs-large tumour-suppressor gene product, DlgA. It consists of a five-stranded antiparallel beta-barrel flanked by three alpha-helices. A groove runs over the surface of the domain, ending in a conserved hydrophobic pocket and a buried arginine; we suggest that this is the binding site for the C-terminal peptide.

• Kennedy MB
• Origin of PDZ (DHR, GLGF) domains.
• Trends Biochem Sci. 1995; 20: 350-350

• Ponting CP, Phillips C
• DHR domains in syntrophins, neuronal NO synthases and other intracellular proteins.
• Trends Biochem Sci. 1995; 20: 102-3

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
20.11	map04530	Tight junction
11.11	map02020	Two-component system - General
6.13	map04520	Adherens junction
5.56	map04810	Regulation of actin cytoskeleton
5.56	map04360	Axon guidance
4.60	map04310	Wnt signaling pathway
4.60	map04916	Melanogenesis
4.60	map05217	Basal cell carcinoma
4.60	map05210	Colorectal cancer
4.60	map04330	Notch signaling pathway
2.87	map03050	Proteasome
2.30	map03090	Type II secretion system
2.11	map04670	Leukocyte transendothelial migration
1.92	map05050	Dentatorubropallidoluysian atrophy (DRPLA)
1.92	map04080	Neuroactive ligand-receptor interaction
1.53	map00230	Purine metabolism
1.34	map05120	Epithelial cell signaling in Helicobacter pylori infection
1.34	map04662	B cell receptor signaling pathway
1.34	map04660	T cell receptor signaling pathway
1.34	map04540	Gap junction
1.15	map05222	Small cell lung cancer
1.15	map04020	Calcium signaling pathway
1.15	map04010	MAPK signaling pathway
1.15	map00380	Tryptophan metabolism
1.15	map00330	Arginine and proline metabolism
1.15	map04730	Long-term depression
0.57	map00780	Biotin metabolism
0.57	map00310	Lysine degradation
0.38	map00632	Benzoate degradation via CoA ligation
0.38	map00562	Inositol phosphate metabolism
0.19	map04920	Adipocytokine signaling pathway
0.19	map05214	Glioma
0.19	map03060	Protein export
0.19	map04910	Insulin signaling pathway
0.19	map05215	Prostate cancer
0.19	map04012	ErbB signaling pathway
0.19	map04150	mTOR signaling pathway
0.19	map05221	Acute myeloid leukemia
0.19	map04930	Type II diabetes mellitus

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with PDZ domain which could be assigned to a KEGG orthologous group, and not all proteins containing PDZ domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of PDZ domains in PDB

PDB code	Title
1b8q	Solution structure of the extended neuronal nitric oxide synthase pdz domain complexed with an associated peptide
1be9	The third pdz domain from the synaptic protein psd-95 in complex with a c-terminal peptide derived from cript.
1bfe	The third pdz domain from the synaptic protein psd-95
1d5g	Solution structure of the pdz2 domain from human phosphatase hptp1e complexed with a peptide
1fc6	Photosystem ii d1 c-terminal processing protease
1fc7	Photosystem ii d1 c-terminal processing protease
1fc9	Photosystem ii d1 c-terminal processing protease
1fcf	Photosystem ii d1 c-terminal processing protease
1g9o	First pdz domain of the human na+/h+ exchanger regulatory factor
1gm1	Second pdz domain (pdz2) of ptp-bl
1gq4	Structural determinants of the nherf interaction with beta2ar and pdgfr
1gq5	Structural determinants of the nherf interaction with beta2-ar and pdgfr
1i16	Structure of interleukin 16: implications for function, nmr, structures
1i92	Structural basis of the nherf pdz1-cftr interaction
1ihj	Crystal structure of the n-terminal pdz domain of inad in complex with a norpa c-terminal peptide
1iu0	The first pdz domain of psd-95
1iu2	The first pdz domain of psd-95
1kef	Pdz1 of sap90
1kwa	Human cask/lin-2 pdz domain
1ky9	Crystal structure of degp (htra)
1l6o	Xenopus dishevelled pdz domain
1lcy	Crystal structure of the mitochondrial serine protease htra2
1m5z	The pdz7 of glutamate receptor interacting protein binds to its target via a novel hydrophobic surface area
1mc7	Solution structure of mdvl1 pdz domain
1mfg	The structure of erbin pdz domain bound to the carboxy- terminal tail of the erbb2 receptor
1mfl	The structure of erbin pdz domain bound to the carboxy- terminal tail of the erbb2 receptor
1n7e	Crystal structure of the sixth pdz domain of grip1
1n7f	Crystal structure of the sixth pdz domain of grip1 in complex with liprin c-terminal peptide
1n7t	Erbin pdz domain bound to a phage-derived peptide
1n99	Crystal structure of the pdz tandem of human syntenin
1nf3	Structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6
1nte	Crystal structure analysis of the second pdz domain of syntenin
1obx	Crystal structure of the complex of pdz2 of syntenin with an interleukin 5 receptor alpha peptide.
1oby	Crystal structure of the complex of pdz2 of syntenin with a syndecan-4 peptide.
1obz	Crystal structure of the complex of the pdz tandem of syntenin with an interleukin 5 receptor alpha peptide.
1ozi	The alternatively spliced pdz2 domain of ptp-bl
1p1d	Structural insights into the inter-domain chaperoning of tandem pdz domains in glutamate receptor interacting proteins
1p1e	Structural insights into the inter-domain chaperoning of tandem pdz domains in glutamate receptor interacting proteins
1pdr	Crystal structure of the third pdz domain from the human homolog of discs large protein
1q3o	Crystal structure of the shank pdz-ligand complex reveals a class i pdz interaction and a novel pdz-pdz dimerization
1q3p	Crystal structure of the shank pdz-ligand complex reveals a class i pdz interaction and a novel pdz-pdz dimerization
1q7x	Solution structure of the alternatively spliced pdz2 domain (pdz2b) of ptp-bas (hptp1e)
1qau	Unexpected modes of pdz domain scaffolding revealed by structure of nnos-syntrophin complex
1qav	Unexpected modes of pdz domain scaffolding revealed by structure of nnos-syntrophin complex
1qlc	Solution structure of the second pdz domain of postsynaptic density-95
1r6j	Ultrahigh resolution crystal structure of syntenin pdz2
1rgr	Cyclic peptides targeting pdz domains of psd-95: structural basis for enhanced affinity and enzymatic stability
1rgw	Solution structure of zasp's pdz domain
1ry4	Nmr structure of the crib-pdz module of par-6
1rzx	Crystal structure of a par-6 pdz-peptide complex
1sot	Crystal structure of the degs stress sensor
1soz	Crystal structure of degs protease in complex with an activating peptide
1t2m	Solution structure of the pdz domain of af-6
1te0	Structural analysis of degs, a stress sensor of the bacterial periplasm
1tp3	Pdz3 domain of psd-95 protein complexed with kketpv peptide ligand
1tp5	Crystal structure of pdz3 domain of psd-95 protein complexed with a peptide ligand kketwv
1tq3	Higher resolution crystal structure of the third pdz domain of post synaptic psd-95 protein
1u37	Auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
1u38	Auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
1u39	Auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
1u3b	Auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
1uep	Solution structure of the third pdz domain of human atrophin-1 interacting protein 1 (kiaa0705 protein)
1ueq	Solution structure of the first pdz domain of human atrophin-1 interacting protein 1 (kiaa0705 protein)
1uew	Solution structure of the forth pdz domain of human atrophin-1 interacting protein 1 (kiaa0705 protein)
1uez	Solution structure of the first pdz domain of human kiaa1526 protein
1uf1	Solution structure of the second pdz domain of human kiaa1526 protein
1ufx	Solution structure of the third pdz domain of human kiaa1526 protein
1uhp	Solution structure of rsgi ruh-005, a pdz domain in human cdna, kiaa1095
1uit	Solution structure of rsgi ruh-006, the third pdz domain of hdlg5 (kiaa0583) protein [homo sapiens]
1ujd	Solution structure of rsgi ruh-003, a pdz domain of hypothetical kiaa0559 protein from human cdna
1uju	Solution structure of the fourth pdz domain of human scribble (kiaa0147 protein)
1ujv	Solution structure of the second pdz domain of human membrane associated guanylate kinase inverted-2 (magi-2)
1um1	Solution structure of rsgi ruh-007, pdz domain in human cdna
1um7	Solution structure of the third pdz domain of synapse- associated protein 102
1v1t	Crystal structure of the pdz tandem of human syntenin in complex with tneykv peptide
1v5l	Solution structure of pdz domain of mouse alpha-actinin-2 associated lim protein
1v5q	Solution structure of the pdz domain from mouse glutamate receptor interacting protein 1a-l (grip1) homolog
1v62	Solution structure of the 3rd pdz domain of grip2
1v6b	Solution structure of the third pdz domain of mouse harmonin
1va8	Solution structure of the pdz domain of pals1 protein
1vae	Solution structure of the pdz domain of mouse rhophilin-2
1vb7	Solution structure of the pdz domain of pdz and lim domain 2
1vcw	Crystal structure of degs after backsoaking the activating peptide
1vj6	Pdz2 from ptp-bl in complex with the c-terminal ligand from the apc protein
1w9e	Crystal structure of the pdz tandem of human syntenin in complex with tnefyf peptide
1w9o	Crystal structure of the pdz tandem of human syntenin in complex with tneyyv peptide
1w9q	Crystal structure of the pdz tandem of human syntenin in complex with tnefaf peptide
1wf7	Solution structure of the pdz domain of enigma homologue protein
1wf8	Solution structure of the pdz domain of spinophilin/neurabinii protein
1wfg	Pdz domain of human rim2b
1wfv	Solution structure of the fifth pdz domain of human membrane associated guanylate kinase inverted-2 (kiaa0705 protein)
1wg6	Solution structure of pdz domain in protein xp_110852
1wh1	Solution structure of the fourth pdz domain of kiaa1095 protein
1wha	Solution structure of the second pdz domain of human scribble (kiaa0147 protein).
1whd	Solution structure of the pdz domain of rgs3
1wi2	Solution structure of the pdz domain from riken cdna 2700099c19
1wi4	Solution structure of the pdz domain of syntaxin binding protein 4
1wif	The solution structure of rsgi ruh-020, a pdz domain of hypothetical protein from mouse
1wjl	Solution structure of pdz domain of mouse cypher protein
1x45	Solution structure of the first pdz domain of amyloid beta a4 precursor protein-binding family a, member 1
1x5n	Solution structure of the second pdz domain of harmonin protein
1x5q	Solution structure of the first pdz domain of scribble homolog protein (hscrib)
1x5r	Solution structure of the fourth pdz domain of glutamate receptor interacting protein 2
1x6d	Solution structures of the pdz domain of human interleukin-
1x8s	Structure of the par-6 pdz domain with a pals1 internal ligand
1xz9	Structure of af-6 pdz domain
1y7n	Solution structure of the second pdz domain of the human neuronal adaptor x11alpha
1y8t	Crystal structure of rv0983 from mycobacterium tuberculosis- proteolytically active form
1ybo	Crystal structure of the pdz tandem of human syntenin with syndecan peptide
1z86	Solution structure of the pdz domain of alpha-syntrophin
1z87	Solution structure of the split ph-pdz supramodule of alpha- syntrophin
1zok	Pdz1 domain of synapse associated protein 97
1zub	Solution structure of the rim1alpha pdz domain in complex with an elks1b c-terminal peptide
2ain	Solution structure of the af-6 pdz domain complexed with the c-terminal peptide from the bcr protein
2awu	Synapse associated protein 97 pdz2 domain variant c378g
2aww	Synapse associated protein 97 pdz2 domain variant c378g with c-terminal glur-a peptide
2awx	Synapse associated protein 97 pdz2 domain variant c378s
2byg	2nd pdz domain of discs large homologue 2
2cs5	Solution structure of pdz domain of protein tyrosine phosphatase, non-receptor type 4
2csj	Solution structure of n-terminal pdz domain from mouse tjp2
2css	Solution structure of the pdz domain of human kiaa0340 protein
2d8i	Solution structure of the pdz domain of t-cell lymphoma invasion and metastasis 1 varian
2d90	Solution structure of the third pdz domain of pdz domain containing protein 1
2d92	Solution structure of the fifth pdz domain of inad-like protein
2daz	Solution structure of the 7th pdz domain of inad-like protein
2db5	Solution structure of the first pdz domain of inad-like protein
2dc2	Solution structure of pdz domain
2djt	Solution structures of the pdz domain of human unnamed protein product
2dkr	Solution structure of the pdz domain from human lin-7 homolog b
2dls	Solution structure of the pdz domain of human rho guanine nucleotide exchange factor 11
2dlu	Solution structure of the second pdz domain of human inad- like protein
2dm8	Solution structure of the eighth pdz domain of human inad- like protein
2dmz	Solution structure of the third pdz domain of human inad- like protein
2e7k	Solution structure of the pdz domain from human maguk p55 subfamily member 2
2eaq	Crystal structure of pdz domain of kiaa0858 (lim), ms0793 from homo sapiens
2edp	Solution structure of the pdz domain from human shroom family member 4
2edv	Solution structure of the pdz domain from human ferm and pdz domain containing 1
2edz	Solution structures of the pdz domain of mus musculus pdz domain-containing protein 1
2eeg	Solution structure of pdz domain of pdz and lim domain protein
2eeh	Solution structure of first pdz domain of pdz domain containing protein 7
2eei	Solution structure of second pdz domain of pdz domain containing protein 1
2eej	Solution structure of fourth pdz domain of pdz domain containing protein 1
2egk	Crystal structure of tamalin pdz-intrinsic ligand fusion protein
2egn	Crystal structure of tamalin pdz domain in complex with mglur5 c-terminal peptide
2ego	Crystal structure of tamalin pdz domain
2ehr	Solution structure of the sixth pdz domain of human inad- like protein
2ejy	Solution structure of the p55 pdz t85c domain complexed with the glycophorin c f127c peptide
2eno	Solution structure of the pdz domain from human synaptojanin 2 binding protein
2ev8	Solution structure of the erythroid p55 pdz domain
2exg	Making protein-protein interactions drugable: discovery of low-molecular-weight ligands for the af6 pdz domain
2f0a	Crystal structure of monomeric uncomplexed form of xenopus dishevelled pdz domain
2f5y	Crystal structure of the pdz domain from human rgs-3
2fcf	The crystal structure of the 7th pdz domain of mpdz (mupp-1)
2fe5	The crystal structure of the second pdz domain of human dlg3
2fn5	Nmr structure of the neurabin pdz domain (502-594)
2fne	The crystal structure of the 13th pdz domain of mpdz
2g2l	Crystal structure of the second pdz domain of sap97 in complex with a glur-a c-terminal peptide
2g5m	Spinophilin pdz domain
2gzv	The cystal structure of the pdz domain of human pick1 (casp target)
2h2b	Crystal structure of zo-1 pdz1 bound to a phage-derived ligand (wrrttyl)
2h2c	Crystal structure of zo-1 pdz1 bound to a phage-derived ligand (wrrttwv)
2h3l	Crystal structure of erbin pdz
2h3m	Crystal structure of zo-1 pdz1
2he2	Crystal structure of the 3rd pdz domain of human discs large homologue 2, dlg2
2he4	The crystal structure of the second pdz domain of human nherf-2 (slc9a3r2) interacting with a mode 1 pdz binding motif
2hga	Solution nmr structure of conserved protein mth1368, northeast structural genomics consortium target tt821a
2i04	X-ray crystal structure of magi-1 pdz1 bound to the c- terminal peptide of hpv18 e6
2i0i	X-ray crystal structure of sap97 pdz3 bound to the c- terminal peptide of hpv18 e6
2i0l	X-ray crystal structure of sap97 pdz2 bound to the c- terminal peptide of hpv18 e6.
2i1n	Crystal structure of the 1st pdz domain of human dlg3
2iwn	3rd pdz domain of multiple pdz domain protein mpdz (casp target)
2iwo	12th pdz domain of multiple pdz domain protein mpdz (casp target)
2iwp	12th pdz domain of multiple pdz domain protein mpdz (casp target)
2iwq	7th pdz domain of multiple pdz domain protein mpdz
2jik	Crystal structure of pdz domain of synaptojanin-2 binding protein
2jil	Crystal structure of 2nd pdz domain of glutamate receptor interacting protein-1 (grip1)
2jin	Crystal structure of pdz domain of synaptojanin-2 binding protein
2joa	Htra1 bound to an optimized peptide: nmr assignment of pdz domain and ligand resonances
2jre	C60-1, a pdz domain designed using statistical coupling analysis
2jwe	Solution structure of the second pdz domain from human zonula occludens-1: a dimeric form with 3d domain swapping
2jxo	Structure of the second pdz domain of nherf-1
2k1z	Solution structure of par-3 pdz3
2k20	Solution structure of par-3 pdz3 in complex with pten peptide
2ka9	Solution structure of psd-95 pdz12 complexed with cypin peptide
2kaw	Nmr structure of the mdvl1 pdz domain in complex with its inhibitor
2kbs	Solution structure of harmonin pdz2 in complex with the carboxyl tail peptide of cadherin23
2kjk	Solution structure of the second domain of the listeria protein lin2157, northeast structural genomics consortium target lkr136b
2kjp	Solution structure of protein ylbl (bsu15050) from bacillus subtilis, northeast structural genomics consortium target sr713a
2kl1	Solution structure of gtr34c from geobacillus thermodenitrificans. northeast structural genomics consortium target gtr34c
2koj	Solution structure of mouse par-3 pdz2 (residues 450-558)
2kom	Solution structure of humar par-3b pdz2 (residues 451-549)
2o2t	The crystal structure of the 1st pdz domain of mpdz
2ocs	The crystal structure of the first pdz domain of human nherf-2 (slc9a3r2)
2ogp	Solution structure of the second pdz domain of par-3
2omj	Solution structure of larg pdz domain
2opg	The crystal structure of the 10th pdz domain of mpdz
2oqs	Structure of the hdlg/sap97 pdz2 in complex with hpv-18 papillomavirus e6 peptide
2os6	Solution structure of larg pdz domain in complex with c- terminal octa-peptide of plexin b1
2osg	Solution structure and binding property of the domain- swapped dimer of zo2pdz2
2ozf	The crystal structure of the 2nd pdz domain of the human nherf-1 (slc9a3r1)
2p3w	Crystal structure of the htra3 pdz domain bound to a phage- derived ligand (fgrwv)
2pa1	Structure of the pdz domain of human pdlim2 bound to a c- terminal extension from human beta-tropomyosin
2pdz	Solution structure of the syntrophin pdz domain in complex with the peptide gvkeslv, nmr, 15 structures
2pkt	Crystal structure of the human clp-36 (pdlim1) bound to the c-terminal peptide of human alpha-actinin-1
2pku	Solution structure of pick1 pdz in complex with the carboxyl tail peptide of glur2
2pnt	Crystal structure of the pdz domain of human grasp (grp1) in complex with the c-terminal peptide of the metabotropic glutamate receptor type 1
2pzd	Crystal structure of the htra2/omi pdz domain bound to a phage-derived ligand (wtmfwv)
2q3g	Structure of the pdz domain of human pdlim7 bound to a c- terminal extension from human beta-tropomyosin
2q9v	Crystal structure of the c890s mutant of the 4th pdz domain of human membrane associated guanylate kinase
2qbw	The crystal structure of pdz-fibronectin fusion protein
2qg1	Crystal structure of the 11th pdz domain of mpdz (mupp1)
2qkt	Crystal structure of the 5th pdz domain of inad
2qku	The 5th pdz domain of inad in 10mm dtt
2qkv	Crystal structure of the c645s mutant of the 5th pdz domain of inad
2qt5	Crystal structure of grip1 pdz12 in complex with the fras1 peptide
2r3y	Crystal structure of the degs protease in complex with the ywf activating peptide
2r4h	Crystal structure of a c1190s mutant of the 6th pdz domain of human membrane associated guanylate kinase
2rcz	Structure of the second pdz domain of zo-1
2rey	Crystal structure of the pdz domain of human dishevelled 2 (homologous to drosophila dsh)
2uzc	Structure of human pdlim5 in complex with the c-terminal peptide of human alpha-actinin-1
2v1w	Crystal structure of human lim protein ril (pdlim4) pdz domain bound to the c-terminal peptide of human alpha- actinin-1
2v90	Crystal structure of the 3rd pdz domain of intestine- and kidney-enriched pdz domain ikepp (pdzd3)
2vph	Crystal structure of the human protein tyrosine phosphatase, non-receptor type 4, pdz domain
2vrf	Crystal structure of the human beta-2-syntrophin pdz domain
2vsp	Crystal structure of the fourth pdz domain of pdz domain- containing protein 1
2vsv	Crystal structure of the pdz domain of human rhophilin-2
2vwr	Crystal structure of the second pdz domain of numb-binding protein 2
2vz5	Structure of the pdz domain of tax1 (human t-cell leukemia virus type i) binding protein 3
2w4f	Crystal structure of the first pdz domain of human scrib1
2w7r	Structure of the pdz domain of human microtubule associated serine-threonine kinase 4
2yt7	Solution structure of the pdz domain of amyloid beta a4 precursor protein-binding family a member 3
2yt8	Solution structure of the pdz domain of amyloid beta a4 precursor protein-binding family a member 3 (neuron- specific x11l2 protein) (neuronal munc18-1-interacting protein 3) (mint-3) (adapter protein x11gamma)
2ytw	Solution structure of the pdz-domain of human protease htra precursor
2yub	Solution structure of the pdz domain from mouse lim domain kinase
2yuy	Solution structure of pdz domain of rho gtpase activating protein 21
2z17	Crystal sturcture of pdz domain from human pleckstrin homology, sec7
2z9i	Crystal structure of rv0983 from mycobacterium tuberculosis- proteolytically active form
2zle	Cryo-em structure of degp12/omp
2zpm	Crystal structure analysis of pdz domain b
3b76	Crystal structure of the third pdz domain of human ligand- of-numb protein-x (lnx1) in complex with the c-terminal peptide from the coxsackievirus and adenovirus receptor
3bpu	Crystal structure of the 3rd pdz domain of human membrane associated guanylate kinase, c677s and c709s double mutant
3cbx	The dvl2 pdz domain in complex with the c1 inhibitory peptide
3cby	The dvl2 pdz domain in complex with the n1 inhibitory peptide
3cbz	The dvl2 pdz domain in complex with the n2 inhibitory peptide
3cc0	The dvl2 pdz domain in complex with the n3 inhibitory peptide
3ch8	The crystal structure of pdz-fibronectin fusion protein
3cs0	Crystal structure of degp24
3cyy	The crystal structure of zo-1 pdz2 in complex with the cx43 peptide
3diw	C-terminal beta-catenin bound tip-1 structure
3dj1	Crystal structure of tip-1 wild type
3dj3	Crystal structure of c-terminal truncated tip-1 (6-113)
3e17	Crystal structure of the second pdz domain from human zona occludens-2
3fy5	Dishevelled pdz domain homodimer
3gcn	Crystal structure of degs h198p/d320a mutant modified by dfp in complex with omp peptide (yqf)
3gco	Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyqf omp peptide
3gds	Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyyf peptide
3gdu	Crystal structure of degs h198p/d320a mutant modified by dfp and in complex with yrf peptide
3gdv	Crystal structure of degs h198p/d320a mutant modified by dfp and in complex with yqf peptide
3gge	Crystal structure of the pdz domain of pdz domain- containing protein gipc2
3i18	Crystal structure of the pdz domain of the sdrc-like protein (lmo2051) from listeria monocytogenes, northeast structural genomics consortium target lmr166b
3i1e	Crystal structure of the pdz domain of the sdrc-like protein (lin2157) from listeria innocua, northeast structural genomics consortium target lkr136c
3id2	Crystal structure of rsep pdz2 domain
3id3	Crystal structure of rsep pdz2 i304a domain
3id4	Crystal structure of rsep pdz2 domain fused gkaspv peptide
3k50	Crystal structure of putative s41 protease (yp_211611.1) from bacteroides fragilis nctc 9343 at 2.00 a resolution
3pdz	Solution structure of the pdz2 domain from human phosphatase hptp1e

Links (links to other resources describing this domain)

• PFAM: PF00595
• INTERPRO: IPR001478