The domain within your query sequence starts at position 18 and ends at position 161; the E-value for the PGRP domain shown below is 8.93e-75.

SFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGW
CDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALN
LLECGVSRGFLRSNYEVKGHRDVQ

PGRP

Animal peptidoglycan recognition proteins homologous to Bacteriophage T3 lysozyme.
PGRP
SMART accession number:SM00701
Description: The bacteriophage molecule, but not its moth homologue, has been shown to have N-acetylmuramoyl-L-alanine amidase activity. One member of this family, Tag7, is a cytokine.
Interpro abstract (IPR006619):

This domain is found in a family of animal peptidoglycan recognition proteins homologous to Bacteriophage T3 lysozyme [ (PUBMED:9707603) ], and some bacterial homologues. The bacteriophage molecule, but not its moth homologue, has been shown to have N-acetylmuramoyl-L-alanine amidase activity. One member of this family, Tag7, is a cytokine [ (PUBMED:9660837) ].

GO process:peptidoglycan catabolic process (GO:0009253)
GO function:N-acetylmuramoyl-L-alanine amidase activity (GO:0008745), zinc ion binding (GO:0008270)
Family alignment:
View or

There are 5568 PGRP domains in 5206 proteins in SMART's nrdb database.

Click on the following links for more information.