The domain within your query sequence starts at position 22 and ends at position 180; the E-value for the PIP49_N domain shown below is 2.18e-90.

GRLPGLRVKYVLLVWLGIFVGSWMVYVHYSSYSELCRGHVCQVVICDQYRKGIISGSVCQ
DLCELQKVEWRTCLSSAPGQQVYSGLWQDKEVTIKCGIEEALNSKAWPDAAPRRELVLFD
KPTRGTSIKEFREMTLSFLKANLGDLPSLPALVDQILLM

PIP49_N

N-term cysteine-rich ER, FAM69
PIP49_N
SMART accession number:SM01299
Description: The FAM69 family of cysteine-rich type II transmembrane proteins localise to the endoplasmic reticulum (ER) in cultured cells, probably via N-terminal di-arginine motifs. These proteins carry at least 14 luminal cysteines which are conserved in all FAM69s. There are currently few indications of the involvement of FAM69 members in human diseases PMID:21334309. It would appear that FAM69 proteins are predicted to be have a protein kinase structure and function. Analysis of three-dimensional structure models and conservation of the classic catalytic motifs of protein kinases in four of human FAM69 proteins suggests they might have retained catalytic phosphotransferase activity. An EF-hand Ca2+-binding domain, inserted within the structure of the kinase domain, suggests they function as Ca2+-dependent kinases (unpublished).
Interpro abstract (IPR029244):

The FAM69 family of cysteine-rich type II transmembrane proteins localise to the endoplasmic reticulum (ER) in cultured cells, probably via N-terminal di-arginine motifs. These proteins carry at least 14 luminal cysteines which are conserved in all FAM69s. There are currently few indications of the involvement of FAM69 members in human diseases [ (PUBMED:21334309) ]. It would appear that FAM69 proteins are predicted to be have a protein kinase structure and function. Analysis of three-dimensional structure models and conservation of the classic catalytic motifs of protein kinases in four of human FAM69 proteins suggests they might have retained catalytic phosphotransferase activity. An EF-hand Ca2+-binding domain, inserted within the structure of the kinase domain, suggests they function as Ca2+-dependent kinases [ (PUBMED:23840464) ].

Family alignment:
View or

There are 1191 PIP49_N domains in 1191 proteins in SMART's nrdb database.

Click on the following links for more information.