The domain within your query sequence starts at position 62 and ends at position 405; the E-value for the PIPKc domain shown below is 1.19e-169.

MPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSAP
LPNDSQARSGARFHTSYDKRYVIKTITSEDVAEMHNILKKYHQYIVECHGVTLLPQFLGM
YRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAKELPTLKDNDFINE
GQKIYIDDNNKKIFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVECEENDGEEE
GESDSTHPIGTPPDSPGNTLNSSPPLAPGEFDPNIDVYAIKCHENAPRKEVYFMAIIDIL
THYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHIL

PIPKc

Phosphatidylinositol phosphate kinases
PIPKc
SMART accession number:SM00330
Description: -
Interpro abstract (IPR002498): This entry represents a conserved region from the common kinase core found in the type I phosphatidylinositol-4-phosphate 5-kinase (PIP5K) family as described in [(PUBMED:9535851)]. This region is found in I, II and III phosphatidylinositol-4-phosphate 5-kinases (PIP5K enzymes). PIP5K catalyses the formation of phosphoinositol-4,5-bisphosphate via the phosphorylation of phosphatidylinositol-4-phosphate a precursor in the phosphinositide signalling pathway.
GO process:phosphatidylinositol metabolic process (GO:0046488)
GO function:phosphatidylinositol phosphate kinase activity (GO:0016307)
Family alignment:
View or

There are 3642 PIPKc domains in 3635 proteins in SMART's nrdb database.

Click on the following links for more information.