The domain within your query sequence starts at position 286 and ends at position 338; the E-value for the PSP domain shown below is 3.04e-27.

FGRFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLKEAELENSGLAL

PSP

proline-rich domain in spliceosome associated proteins
PSP
SMART accession number:SM00581
Description: -
Interpro abstract (IPR006568):

PSP is a proline-rich domain of unknown function found in spliceosome associated proteins.

Family alignment:
View or

There are 2532 PSP domains in 2527 proteins in SMART's nrdb database.

Click on the following links for more information.