The domain within your query sequence starts at position 34 and ends at position 113; the E-value for the PTN domain shown below is 4.2e-53.

CSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDG
STGTKARQGTLKKARYNAQC

PTN

Pleiotrophin / midkine family
PTN
SMART accession number:SM00193
Description: Heparin-binding domain family.
Interpro abstract (IPR000762):

Several extracellular heparin-binding proteins involved in regulation of growth and differentiation belong to a new family of growth factors. These growth factors are highly related proteins of about 140 amino acids that contain 10 conserved cysteines probably involved in disulphide bonds, and include pleiotrophin [ (PUBMED:15121180) ] (also known as heparin-binding growth-associated molecule HB-GAM, heparin-binding growth factor 8 HBGF-8, heparin-binding neutrophic factor HBNF and osteoblast specific protein OSF-1); midkine (MK) [ (PUBMED:15047154) ]; retinoic acid-induced heparin-binding protein (RIHB) [ (PUBMED:7796887) ]; and pleiotrophic factors alpha-1and -2 and beta-1 and -2 from Xenopus laevis, the homologues of midkine and pleiotrophin respectively. Pleiotrophin is a heparin-binding protein that has neurotrophic activity and has mitogenic activity towards fibroblasts. It is highly expressed in brain and uterus tissues, but is also found in gut, muscle and skin. It is thought to possess an important brain-specific function. Midkine is a regulator of differentiation whose expression is regulated by retinoic acid, and, like pleiotrophin, is a heparin-binding growth/differentiation factor that acts on fibroblasts and nerve cells.

GO function:growth factor activity (GO:0008083)
Family alignment:
View or

There are 691 PTN domains in 689 proteins in SMART's nrdb database.

Click on the following links for more information.