The domain within your query sequence starts at position 164 and ends at position 333; the E-value for the PTPlike_phytase domain shown below is 4.33e-53.

FCVREEPVVFLRAEEDFVSYTPRDKESLHENLRDPSPGVKAENLELAIQKEIHDFAQLRD
NVYHVYHNTEDLRGEPHTVAIRGEDGVCVTEEVFKRPLFLQPTYRYHRLPLPEQGAPLEA
QFDAFVSVLRETPSLLPLRDNHGPLPALLFSCQSGVGRTNLGMVLGTLVM

PTPlike_phytase

Inositol hexakisphosphate
PTPlike_phytase
SMART accession number:SM01301
Description: Inositol hexakisphosphate, often called phytate, is found in abundance in seeds and acting as an inorganic phosphate reservoir. Phytases are phosphatases that hydrolyze phytate to less-phosphorylated myo-inositol derivatives and inorganic phosphate. The active-site sequence (HCXXGXGR) of the phytase identified from the gut micro-organism Selenomonas ruminantium forms a loop (P loop) at the base of a substrate binding pocket that is characteristic of protein tyrosine phosphatases (PTPs). The depth of this pocket is an important determinant of the substrate specificity of PTPs. In humans this enzyme is thought to aid bone mineralization and salvage the inositol moiety prior to apoptosis PMID:9923613.
Family alignment:
View or

There are 2612 PTPlike_phytase domains in 1487 proteins in SMART's nrdb database.

Click on the following links for more information.