The domain within your query sequence starts at position 173 and ends at position 247; the E-value for the PUR domain shown below is 1.25e-19.

VLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQDQTIVLPAQGM
IEFRDALVQLIEDYG

PUR

DNA/RNA-binding repeats in PUR-alpha/beta/gamma and in hypothetical proteins from spirochetes and the Bacteroides-Cytophaga-Flexibacter bacteria.
PUR
SMART accession number:SM00712
Description: -
Interpro abstract (IPR006628):

The purine-rich element binding (Pur) protein family protein consists PURalpha/beta/gamma in humans. Pur-alpha is a highly conserved, sequence-specific DNA- and RNA-binding protein involved in diverse cellular and viral functions including transcription, replication, and cell growth. Pur-alpha has a modular structure with alternating three basic aromatic class I and two acidic leucine-rich class II repeats in the central region of the protein [ (PUBMED:1448097) ].

In addition to its involved in basic cellular function, Pur-alpha, has been implicated in the development of blood cells and cells of the central nervous system; it has also been implicated in the inhibition of oncogenic transformation and along with Pur-beta in myelodysplastic syndrome progressing to acute myelogenous leukemia. Pur-alpha can influence viral interaction through functional associations, for example with the Tat protein and TAR RNA of HIV-1, and with large T-antigen and DNA regulatory regions of JC virus. JC virus causes opportunistic infections in the brains of certain HIV-1-infected individuals [ (PUBMED:12894583) ].

GO function:RNA polymerase II transcription regulatory region sequence-specific DNA binding (GO:0000977), purine-rich negative regulatory element binding (GO:0032422)
Family alignment:
View or

There are 4151 PUR domains in 1448 proteins in SMART's nrdb database.

Click on the following links for more information.