The domain within your query sequence starts at position 220 and ends at position 285; the E-value for the PWWP domain shown below is 3.84e-15.

YNVGDLVWSKVSGYPWWPCMVSADPLLHNHTKLKGQKKSARQYHVQFFGDAPERAWIFEK
SLVAFE

PWWP

domain with conserved PWWP motif
PWWP
SMART accession number:SM00293
Description: conservation of Pro-Trp-Trp-Pro residues
Interpro abstract (IPR000313):

The PWWP domain is an around 70 amino acids domain that was named after its central core 'Pro-Trp-Trp-Pro'. The PWWP domain is found in one or, less frequently, in two copies in nuclear, often DNA-binding proteins that function as transcription factors regulating developmental processes. Due to its position, the composition of amino acids close to the PWWP motif and the pattern of other domains present, it has been proposed that the PWWP domain is involved in protein-protein interactions [(PUBMED:10802047)].

Conservation of the PWWP domain is concentrated on one major and two minor blocks with length differences occurring in between [(PUBMED:10802047)].

Family alignment:
View or

There are 7446 PWWP domains in 6224 proteins in SMART's nrdb database.

Click on the following links for more information.