The domain within your query sequence starts at position 2287 and ends at position 2321; the E-value for the PbH1 domain shown below is 2.23e3.

EQGSTIRNNVIISVSAAEGLSGSEMLAPAGIYTFS

PbH1

Parallel beta-helix repeats
PbH1
SMART accession number:SM00710
Description: The tertiary structures of pectate lyases and rhamnogalacturonase A show a stack of parallel beta strands that are coiled into a large helix. Each coil of the helix represents a structural repeat that, in some homologues, can be recognised from sequence information alone. Conservation of asparagines might be connected with asparagine-ladders that contribute to the stability of the fold. Proteins containing these repeats most often are enzymes with polysaccharide substrates.
Interpro abstract (IPR006626):

The tertiary structures of pectate lyases and rhamnogalacturonase A show a stack of parallel beta strands that are coiled into a large helix. Each coil of the helix represents a structural repeat that, in some homologues, can be recognised from sequence information alone. Conservation of asparagines might be connected with asparagine-ladders that contribute to the stability of the fold. Proteins containing these repeats most often are enzymes with polysaccharide substrates [ (PUBMED:9724625) ].

Family alignment:
View or

There are 585506 PbH1 domains in 92548 proteins in SMART's nrdb database.

Click on the following links for more information.