The domain within your query sequence starts at position 83 and ends at position 149; the E-value for the 2-Hacid_dh_C domain shown below is 1.3e-21.
CGMIMCLARQIPQATASMKDGKWDRKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMK TVGYDPI
2-Hacid_dh_C |
---|
PFAM accession number: | PF02826 |
---|---|
Interpro abstract (IPR006140): | A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related. All contain a glycine-rich region located in the central section of these enzymes, this region corresponds to the NAD-binding domain. This domain is inserted into the catalytic domain. The catalytic domain is described in ( IPR006139 ). |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | NAD binding (GO:0051287) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 2-Hacid_dh_C