The domain within your query sequence starts at position 248 and ends at position 479; the E-value for the 2-oxoacid_dh domain shown below is 8.5e-83.

TGKDRTEPVTGFQKAMVKTMSAALKIPHFGYCDEIDLTQLVKLREELKPVALARGIKLSF
MPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTELGLIVPNVKNVQVRSV
FEIAMELNRLQKLGSSGQLGTTDLTGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGAIK
ALPRFDQKGDVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLL

2-oxoacid_dh

2-oxoacid_dh
PFAM accession number:PF00198
Interpro abstract (IPR001078): This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex EC 2.3.1, which catalyses the overall conversion of alpha-keto acids to acyl-CoA and carbon dioxide [(PUBMED:8487300)]. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3). The domain is also found in the dihydrolipoamide succinyltransferase component of the 2-oxoglutarate dehydrogenase complex EC 2.3.1.61. These proteins contain one to three copies of a lipoyl binding domain followed by the catalytic domain.
GO process:metabolic process (GO:0008152)
GO function:transferase activity, transferring acyl groups (GO:0016746)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 2-oxoacid_dh