The domain within your query sequence starts at position 47 and ends at position 87; the E-value for the 2-oxogl_dehyd_N domain shown below is 6.6e-21.

EPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGA

2-oxogl_dehyd_N

2-oxogl_dehyd_N
PFAM accession number:PF16078
Interpro abstract (IPR032106):

This domain is found at the N terminus of 2-oxoglutarate dehydrogenase component E1 [(PUBMED:1505515)].

2-oxoglutarate dehydrogenase is a key enzyme in the TCA cycle, converting 2-oxoglutarate, coenzyme A and NAD(+) to succinyl-CoA, NADH and carbon dioxide [(PUBMED:16321804)]. This activity of this enzyme is tightly regulated and it is a major determinant of the metabolic flux through the TCA cycle. This enzyme is composed of multiple copies of three different subunits: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3) which is often shared with similar enzymes such as pyruvate dehydrogenase [(PUBMED:9278141)]. The E2 component forms a large multimeric core which binds the peripheral E1 and E3 subunits. The substrate is transferred between the active sites of the different subunits by a lipoyl moiety, bound to a lysine residue from the E2 polypeptide.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 2-oxogl_dehyd_N