The domain within your query sequence starts at position 47 and ends at position 232; the E-value for the 2OG-FeII_Oxy_2 domain shown below is 1.9e-30.

YTVLFGKAEADKIFRELEQEVEYFTGALAKVQVFGKWHSVPRKQATYGDAGLTYTFSGLT
LTPKPWVPVLERVRDRVCEVTGQTFNFVLVNRYKDGCDHIGEHRDDERELAPGSPIASVS
FGACRDFIFRHKDSRGKRPRRTVEVVRLQLAHGSLLMMNPPTNTHWYHSLPIRKRVLAPR
VNLTFR

2OG-FeII_Oxy_2

2OG-FeII_Oxy_2
PFAM accession number:PF13532
Interpro abstract (IPR027450): AlkB is a DNA repair enzyme that removes methyl adducts and some larger alkylation lesions from endocyclic positions on purine and pyrimidine bases. It is a dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron [(PUBMED:12226668), (PUBMED:21068844)]. The catalytic core of AlkB is homologous to other Fe-2OG dioxygenases [(PUBMED:16513174)]. Two discrete global conformations have been observed for AlkB, differing in accessibility of a putative oxygen-diffusion tunnel [(PUBMED:19706517)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 2OG-FeII_Oxy_2