The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the 3-HAO domain shown below is 1e-78.

MERRVRVKSWVEENRASFQPPVCNKLMHQEQLKIMFVGGPNTRKDYHIEEGEEVFYQLEG
DMILRVLEQGQHRDVPIRQGEIFLLPARVPHSPQRFANTMGLVIERRRLESELDGLRYYV
GDTEDVLFEKWFHCKDLGTQLAPIIQEFF

3-HAO

3-HAO
PFAM accession number:PF06052
Interpro abstract (IPR010329):

Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase ( EC 1.13.11.6 ). It is part of the kynurenine pathway for the degradation of tryptophan and the biosynthesis of nicotinic acid [ (PUBMED:9539135) ].The prokaryotic homologue is involved in the 2-nitrobenzoate degradation pathway [ (PUBMED:12620844) ].

The enzyme acts on the tryptophan metabolite 3-hydroxyanthranilate and produces 2-amino-3-carboxymuconate semialdehyde, which can rearrange spontaneously to quinolinic acid and feed into nicotinamide biosynthesis, or undergo further enzymatic degradation.

GO process:oxidation-reduction process (GO:0055114)
GO function:3-hydroxyanthranilate 3,4-dioxygenase activity (GO:0000334), iron ion binding (GO:0005506)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 3-HAO