The domain within your query sequence starts at position 7 and ends at position 51; the E-value for the 3Beta_HSD domain shown below is 2e-12.
LVTGAGGFLGQRIIQLLVQEKDLEEIRVLDKVFKPETREQFFSTQ
3Beta_HSD |
---|
PFAM accession number: | PF01073 |
---|---|
Interpro abstract (IPR002225): | The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones. |
GO process: | steroid biosynthetic process (GO:0006694), oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616), 3-beta-hydroxy-delta5-steroid dehydrogenase activity (GO:0003854) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 3Beta_HSD