The domain within your query sequence starts at position 363 and ends at position 542; the E-value for the 3HCDH_N domain shown below is 1e-54.

QLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSFER
DSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKVLKEVESVTPEHCIFASNTSALPIN
QIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLRQGKVIIVVKDG

3HCDH_N

3HCDH_N
PFAM accession number:PF02737
Interpro abstract (IPR006176):

3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (HCDH) [(PUBMED:3479790)] is an enzyme involved in fatty acid metabolism, it catalyzes the reduction of 3-hydroxyacyl-CoA to 3-oxoacyl-CoA. Most eukaryotic cells have 2 fatty-acid beta-oxidation systems, one located in mitochondria and the other in peroxisomes. In peroxisomes 3-hydroxyacyl-CoA dehydrogenase forms, with enoyl-CoA hydratase (ECH) and 3,2-trans-enoyl-CoA isomerase (ECI) a multifunctional enzyme where the N-terminal domain bears the hydratase/isomerase activities and the C-terminal domain the dehydrogenase activity. There are two mitochondrial enzymes: one which is monofunctional and the other which is, like its peroxisomal counterpart, multifunctional.

In Escherichia coli (gene fadB) and Pseudomonas fragi (gene faoA) HCDH is part of a multifunctional enzyme which also contains an ECH/ECI domain as well as a 3-hydroxybutyryl-CoA epimerase domain [(PUBMED:2204034)].

There are two major regions of similarity in the sequences of proteins of the HCDH family, the first one located in the N-terminal, corresponds to the NAD-binding site, the second one is located in the centre of the sequence. This represents the C-terminal domain which is also found in lambda crystallin. Some proteins include two copies of this domain.

GO process:fatty acid metabolic process (GO:0006631), oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity (GO:0016491), 3-hydroxyacyl-CoA dehydrogenase activity (GO:0003857)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 3HCDH_N