The domain within your query sequence starts at position 202 and ends at position 295; the E-value for the 40S_SA_C domain shown below is 2.9e-30.
YFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTAAQPEVADWSEGVQVPSVPIQQ FPTEDWSAQPATEDWSAAPTAQATEWVGATTEWS
40S_SA_C |
 |
|---|
| PFAM accession number: | PF16122 |
|---|---|
| Interpro abstract (IPR032281): | This domain is found at the C terminus of 40S ribosomal protein SA [ (PUBMED:23137297) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 40S_SA_C