The domain within your query sequence starts at position 235 and ends at position 311; the E-value for the 4HBT domain shown below is 6.7e-13.
QGNTFGGQIMAWMENVATIAASRLCHAHPTLKAIEMFHFRGPSQVGDRLVLKAIVNNAFK HSMEVGVCVEAYRQEAE
4HBT |
![]() |
---|
PFAM accession number: | PF03061 |
---|---|
Interpro abstract (IPR006683): | A wide variety of enzymes contain this domain, principally thioesterases. Proteins containing this domain include 4HBT (4-hydroxybenzoyl-CoA thioesterase) ( EC 3.1.2.23 ) which catalyses the final step in the biosynthesis of 4-hydroxybenzoate from 4-chlorobenzoate in the soil dwelling microbe Pseudomonas CBS-3 [ (PUBMED:9837940) (PUBMED:1610806) ]. It also includes various cytosolic long-chain acyl-CoA thioester hydrolases. Long-chain acyl-CoA hydrolases hydrolyse palmitoyl-CoA to CoA and palmitate, they also catalyse the hydrolysis of other long chain fatty acyl-CoA thioesters [ (PUBMED:8805534) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 4HBT