The domain within your query sequence starts at position 10 and ends at position 198; the E-value for the 5-FTHF_cyc-lig domain shown below is 4.2e-64.

KRGLRAELKQRLRALSAEERLRQSLLLTQKVIAHNQYQNSKRISIFLSMQDEVETEVIIK
DIFKQGKICFIPRYQFQSNHMDMVRLTSSEEIALLPKTSWNIHQPGEGDVREEALSTGGL
DLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVKPYTMALAFKEQICPQIPVDEHD
MKVDEVLYE

5-FTHF_cyc-lig

5-FTHF_cyc-lig
PFAM accession number:PF01812
Interpro abstract (IPR002698):

5-formyltetrahydrofolate cyclo-ligase or methenyl-THF synthetase EC 6.3.3.2 catalyses the interchange of 5-formyltetrahydrofolate (5-FTHF) to 5-10-methenyltetrahydrofolate, this requires ATP and Mg2+ [(PUBMED:8522195)]. 5-FTHF is used in chemotherapy where it is clinically known as Leucovorin [(PUBMED:8034591)].

This entry also includes the 5-formyltetrahydrofolate cyclo-ligase-like protein COG0212 (At1g76730) from Arabidopsis. It does not possess the 5-formyltetrahydrofolate cyclo-ligase activity in vitro and does not complement the growth defect or the characteristic 5- formyltetrahydrofolate accumulation of a 5-FCL-deficient Escherichia coli strain. Instead, it may play a role in thiamin metabolism [(PUBMED:21538139)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 5-FTHF_cyc-lig