The domain within your query sequence starts at position 280 and ends at position 553; the E-value for the 5-nucleotidase domain shown below is 7e-112.

EYQLTNENVILTPGPAFRFVKALQHVNSRLRDLYPDEQDLFDIVLMTNNHAQVGVRLINS
VNHYGLLIDRFCLTGGKSPIGYLKAYLTNLYLSADSEKVQEAIKEGIASATMYAGAKDMA
YCDTQLRVAFDGDAVLFSDESEHIAKDHGLDKFFQHETLFENKPLAQGPLKSFLEDLGKL
QKKFYAKDERLLCPIRTYLVTARSAASSGARVLKTLRRWGLEIDEALFLAGAPKGPILVK
IRPHIFFDDQMFHIESAQKFGTITAHVPYGIAQK

5-nucleotidase

5-nucleotidase
PFAM accession number:PF06189
Interpro abstract (IPR010394):

This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (EC 3.1.3.5), including cytosolic 5'-nucleotidase 1A and 1B (NT5C1A/NT5C1B) from mammals. NT5C1A/NT5C1B dephosphorylate the 5' and 2'(3')-phosphates of deoxyribonucleotides and help to regulate adenosine levels [(PUBMED:11133996)].

GO process:nucleotide metabolic process (GO:0009117)
GO component:cytoplasm (GO:0005737)
GO function:magnesium ion binding (GO:0000287), nucleotide binding (GO:0000166), 5'-nucleotidase activity (GO:0008253)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 5-nucleotidase