The domain within your query sequence starts at position 1430 and ends at position 1551; the E-value for the 53-BP1_Tudor domain shown below is 2.5e-80.

GNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDT
EVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGL
GP

53-BP1_Tudor

53-BP1_Tudor
PFAM accession number:PF09038
Interpro abstract (IPR015125):

This domain consist of two tandem tudor folds with a deep pocket at their interface. The domain is essential for the recruitment of proteins to double stranded breaks in DNA, which is mediated by interaction with methylated Lys 79 of histone H3 [(PUBMED:15525939)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 53-BP1_Tudor